PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G015900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 141aa    MW: 15285.3 Da    PI: 5.0522
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G015900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.32.5e-5418113297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         req+rflPian++rim++ +P+n+ki+kdake++qecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+ylk yre
  Brast08G015900.2.p  18 REQERFLPIANIGRIMRRGVPENGKIAKDAKESIQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLKLYRE 108
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +eg++
  Brast08G015900.2.p 109 MEGDT 113
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-4816122IPR009072Histone-fold
SuperFamilySSF471133.88E-3820121IPR009072Histone-fold
PfamPF008082.1E-262387IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-195169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-197088No hitNo description
PRINTSPR006152.2E-1989107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSDAVGTPEE GGGGAAAREQ ERFLPIANIG RIMRRGVPEN GKIAKDAKES IQECVSEFIS  60
FITSEASDKC MKEKRKTING DDLIWSMGTL GFEDYVEPLK LYLKLYREME GDTTKGSRSE  120
QAGKKGIVLN GQPGSSFNGM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-4618108393NF-YB
4awl_B5e-4618108494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-4618108494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7646031e-156JF764603.1 Hordeum vulgare NF-YB4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567850.12e-98PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotQ65XK11e-73NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4
TrEMBLI1HG702e-98I1HG70_BRADI; Uncharacterized protein
STRINGBRADI2G15800.15e-98(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.17e-56nuclear factor Y, subunit B10